PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000184361
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 692aa    MW: 75912 Da    PI: 7.1276
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000184361genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.78.7e-32292349260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h+k
  MDP0000184361 292 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIIYKGTHDHPK 349
                    8****************************************.***************85 PP

2WRKY105.92.1e-33467525159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  MDP0000184361 467 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 525
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182901.28E-24290350IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-26291350IPR003657WRKY domain
SMARTSM007744.1E-34291349IPR003657WRKY domain
PfamPF031062.2E-24292348IPR003657WRKY domain
PROSITE profilePS5081122.791292350IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-37452527IPR003657WRKY domain
SuperFamilySSF1182903.01E-29459527IPR003657WRKY domain
PROSITE profilePS5081138.825462527IPR003657WRKY domain
SMARTSM007743.1E-39467526IPR003657WRKY domain
PfamPF031064.4E-26468525IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MDATALDXPS GPSDXVDPGD FHPSSEPAFY SSAAASGGAK YKLMSPAKLP ISRSPCLTIP  60
PGLSPTSFLE SPVLLSNMKV TKQWVDKGNG FDGLRXYHVP FCLSLFTVGS GCKYDKNVSI  120
CVCRIRNKCI SKEAEPSPTT GSFLKPQMLY GSLSSTTYSA TTVCSDFNTS DERNSGSFEF  180
KPHARSNXNT GLPNALQLFK VTTDYNHYRN EQPVQVPGQA EPQSHASPTL AKNEMAVSSN  240
ELSLSAPVHT GGASAPVEDD SGDLTQREHP HPGVQTSQGD NKGNGPSVIS SDDGYNWRKY  300
GQKHVKGSEF PRSYYKCTHP NCEVKKLFER SHDGQITEII YKGTHDHPKP QPSRRYNTGA  360
MMPAQEERSD KASSLTGQDD KPSSIYGQMS SNNEPNSTPE LSPVTGNDDS VEGTGSLSNR  420
LPDEVDEDDQ FSKRRRMDVG SIDVTPIVKP IREPRVVVQT LSEVDILDDG YRWRKYGQKV  480
VRGNPNPRSY YKCTNAGCPV RKHVERASHD PKAVITTYEG KHNHDVPTAK SSSHDTSGPT  540
XVNVPSRIRP EESDTISLDL GVGMTSGGEI RTNEHVQLHS DLVERQSHTN SNFRFAQNTP  600
VSTYYGVLNG GMNQYGSREN PSESRSMEIL PLNHSSYPYP QNMGRVLTGE GQKGISVSDR  660
KIKTKRWMPE HVAVCCHLCP KMVILSVAAV DD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-36292527877Probable WRKY transcription factor 4
2lex_A4e-36292527877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.250280.0leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008342208.10.0PREDICTED: probable WRKY transcription factor 20 isoform X1
SwissprotQ93WV00.0WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLM5X2W20.0M5X2W2_PRUPE; Uncharacterized protein
STRINGVIT_19s0090g01720.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39463463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.20.0WRKY family protein